You Searched For: Columbia+Biosciences


23,637  results were found

SearchResultCount:"23637"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (COBSD3-1714-100)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: 9E10]
UOM: 1 * 100 µG


Catalog Number: (COBSD3-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG


Catalog Number: (COBSAP-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (AP (Alkaline Phosphatase)) [clone: M2]
UOM: 1 * 100 µG


Catalog Number: (COBSD11-1711)
Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: AD1.1.10]
UOM: 1 * 100 µG


Catalog Number: (COBSD9-1722)
Supplier: Columbia Biosciences
Description: Anti-HA tag Mouse Monoclonal Antibody (DyLight® 550) [clone: 16B12]
UOM: 1 * 100 µG

Catalog Number: (COBSD5-1714)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 9E10]
UOM: 1 * 100 µG


Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (Europium 1024) [clone: 9E10]

Catalog Number: (COBSHRP-1711)
Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody HRP (Horseradish Peroxidase) [clone: AD1.1.10]
UOM: 1 * 100 µG


Catalog Number: (COBSD3-1760)
Supplier: Columbia Biosciences
Description: Anti-cytokeratins 4, 5, 6, 8, 10, 13, and 18 Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: C11]
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: M2]
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1722)
Supplier: Columbia Biosciences
Description: Anti-HA tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 16B12]
UOM: 1 * 100 µG


Catalog Number: (COBSD10-1718-100)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (DyLight® 650) [clone: M2]
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1864)
Supplier: Columbia Biosciences
Description: Anti-NAD+-dependent 15-hydroxy PGDH Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG


Catalog Number: (COBSD11-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: M2]
UOM: 1 * 100 µG


Catalog Number: (COBSD44-010-100UG)
Supplier: Columbia Biosciences
Description: SureLight® 488 NHS Ester is a bright green fluorescent dye with excitation suited to the 488nm laser line, fluorescent microscopy and flow cytometry. It offers a much more stable signal generation in imaging and flow cytometry than FITC and is half the cost of Alexa Fluor® 488 with no royalties or licensing fees.
UOM: 1 * 100 µG


Catalog Number: (EOLAPP0120)
Supplier: E AND O LABORATORIES
Description: Columbia agar & horse blood 1 * 10 items
UOM: 1 * 10 items


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on 0800 22 33 44.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on 0800 22 33 44
Additional Documentation may be needed to purchase this item. A VWR representative will contact you if needed.
Additional Documentation may be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organisation. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
Product(s) marked with this symbol are discontinued - sold till end of stock. Alternatives may be available by searching with the VWR Catalogue Number listed above. If you need further assistance, please call VWR Customer Service on 0800 22 33 44.
305 - 320 of 23,637
no targeter for Bottom