Print…

You Searched For: Columbia Biosciences


218  results were found

Refine Results Sort by
SearchResultCount:"218"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-COBSD3-1866-50

Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))

Catalog Number: (COBSD3-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG
Image Unavailable-COBSD5-110-1MG

Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Supplier: Columbia Biosciences
Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Image Unavailable-COBSD8-1832

Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 488)

Catalog Number: (COBSD8-1832)
Supplier: Columbia Biosciences
Description: Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 488)
UOM: 1 * 100 µG
Image Unavailable-COBSD5-112-M

Anti-IgM Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-112-M)
Supplier: Columbia Biosciences
Description: Anti-IgM Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG
Product Image-COBSD3-1718-100

Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: M2]

Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: M2]

Image Unavailable-COBSD5-114-100

Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Supplier: Columbia Biosciences
Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Image Unavailable-COBSD5-112-FAB

Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-112-FAB)
Supplier: Columbia Biosciences
Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG
Image Unavailable-COBSD5-1830

Anti-HA tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-1830)
Supplier: Columbia Biosciences
Description: Anti-HA tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG
Image Unavailable-COBSD5-1831

Anti-S Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-1831)
Supplier: Columbia Biosciences
Description: Anti-S Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG
Image Unavailable-COBSD5-1834

Anti-V5 Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-1834)
Supplier: Columbia Biosciences
Description: Anti-V5 Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG
Image Unavailable-COBSD10-1832

Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 650)

Catalog Number: (COBSD10-1832)
Supplier: Columbia Biosciences
Description: Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 650)
UOM: 1 * 100 µG
Image Unavailable-COBSD10-1834

Anti-V5 Tag Rabbit Polyclonal Antibody (DyLight® 650)

Catalog Number: (COBSD10-1834)
Supplier: Columbia Biosciences
Description: Anti-V5 Tag Rabbit Polyclonal Antibody (DyLight® 650)
UOM: 1 * 100 µG
Image Unavailable-COBSB1-1722

Anti-HA tag Mouse Monoclonal Antibody (Biotin) [clone: 16B12]

Catalog Number: (COBSB1-1722)
Supplier: Columbia Biosciences
Description: Anti-HA tag Mouse Monoclonal Antibody (Biotin) [clone: 16B12]
UOM: 1 * 100 µG
Image Unavailable-COBSD3-112-2A

Anti-IgG2a Goat Polyclonal Antibody (APC (Allophycocyanin))

Catalog Number: (COBSD3-112-2A)
Supplier: Columbia Biosciences
Description: Anti-IgG2a Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 100 µG
Image Unavailable-COBSD3-1602B

Mouse IgG2b Isotype Control (APC (Allophycocyanin))

Catalog Number: (COBSD3-1602B)
Supplier: Columbia Biosciences
Description: Mouse IgG2b Isotype Control (APC (Allophycocyanin))
UOM: 1 * 100 µG
Image Unavailable-COBSD3-110-M

Anti-IgM Goat Polyclonal Antibody (APC (Allophycocyanin))

Catalog Number: (COBSD3-110-M)
Supplier: Columbia Biosciences
Description: Anti-IgM Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 100 µG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on 0800 22 33 44.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on 0800 22 33 44
Additional Documentation may be needed to purchase this item. A VWR representative will contact you if needed.
Additional Documentation may be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organisation. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
Product(s) marked with this symbol are discontinued - sold till end of stock. Alternatives may be available by searching with the VWR Catalogue Number listed above. If you need further assistance, please call VWR Customer Service on 0800 22 33 44.
1 - 16 of 218
no targeter for Bottom